A practical reference on reversed-phase HPLC: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-07-16. Anything still debated is marked as such rather than presented as settled.
Verification of a sample usually begins with reversed-phase high-performance liquid chromatography, which resolves the peptide from truncated sequences and other impurities and expresses purity as a percentage of total peak area. Mass spectrometry by electrospray ionisation or matrix-assisted laser desorption supplies an independent check, because the measured mass can be compared against the theoretical value for AEDG. Amino acid analysis or tandem mass spectrometry sequencing can confirm residue order. Each of these methods answers a different question: a purity figure does not establish identity, and an identity match does not establish how much of the material is intact peptide.
The molecule is a short, linear, hydrophilic peptide that dissolves readily in water or aqueous buffer. Its principal chemical liabilities are hydrolytic rather than oxidative, since it contains no cysteine, methionine, or tryptophan residues. The aspartate–glycine step is a recognised site for aspartimide formation under mildly acidic or basic conditions, generating isoaspartate and succinimide-related products over time. Desiccated lyophilised powder held at −20 °C is comparatively stable, whereas dilute solutions degrade faster and are best frozen as single-use aliquots rather than thawed repeatedly.
Epitalon is a synthetic tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. Its design traces to epithalamin, a peptide fraction prepared from bovine pineal gland extracts that researchers in Saint Petersburg began investigating in the 1970s. The compound has a molecular formula of C14H22N4O9 and a nominal molecular mass near 390 daltons. It holds no approved drug status in the United States or the European Union, and material sold under this name is generally offered as a research chemical rather than a finished pharmaceutical product.
Proposed mechanisms centre on cell-culture observations rather than a defined receptor interaction. Several reports describe increased expression of the telomerase catalytic subunit after exposure of cultured human cells, and the authors attributed the effect to short peptide fragments entering the nucleus and influencing gene transcription. No receptor for the tetrapeptide has been identified, and the free peptide is expected to be degraded rapidly by plasma peptidases. Whether any measurable fraction reaches intact tissues after administration remains an unresolved question rather than an established finding.
| Property | Value | Notes |
|---|---|---|
| Identity confirmation | Electrospray or MALDI mass spectrometry | Observed mass compared with theoretical 390.35 Da |
| Purity specification | 95 percent or greater by RP-HPLC | Common convention for research-grade peptide |
| Counter-ion | Acetate or trifluoroacetate | Affects net peptide content of a weighed sample |
| Solution storage | −80 °C as single-use aliquots | Repeated freeze–thaw cycles accelerate loss |
| Main degradation route | Aspartimide formation at Asp-Gly | Produces isoaspartate and related species |
Storage practice centres on limiting moisture, oxygen, and repeated temperature cycling. Freeze-dried powder is generally held desiccated at minus twenty degrees Celsius or colder and protected from light. Reconstituted solutions are markedly less stable, and the aspartate-glycine junction is prone to succinimide formation at neutral to mildly alkaline pH. Portioning material into single-use aliquots reduces degradation compared with repeated freeze-thaw cycles. Stability data specific to this tetrapeptide remain scarce, so most handling guidance is extrapolated from general peptide chemistry rather than measured directly.
Documentation accompanying research peptides usually includes a certificate of analysis listing the batch number, purity figure, and test methods applied. Buyers comparing suppliers should check whether the reported purity refers to chromatographic area or to a mass-balance calculation, because the two are not equivalent. Counter-ion content, residual solvents, and water content are sometimes omitted from such certificates even though they affect the actual peptide mass present. Independent verification through a second laboratory is the most direct way to confirm that a supplied material matches its label.
The four residues give epitalon a molecular formula of C14H22N4O9 and a molecular weight near 390.35 daltons. The presence of two acidic residues, glutamate and aspartate, makes the free peptide strongly acidic, while the alanine and glycine ends provide neutral, nonpolar character. This combination produces a molecule with substantial water solubility. Because there are no cysteine, methionine, or tryptophan residues, the peptide lacks the most common oxidation-sensitive side chains, which simplifies handling compared with many longer peptides.
The proposed relationship between epitalon and pineal function is a central part of its background. Khavinson's group reported that short peptides corresponding to regions of larger pineal proteins could influence gene expression in cells. Epitalon was framed as a synthetic analogue of an active fragment rather than a direct isolation product. Whether the tetrapeptide reproduces the effects of the parent extract is an open question, because comparative studies are limited and the parent extract itself is not a single defined substance.
Interest in epitalon is usually discussed within the broader field of short peptide bioregulators, a category that includes other synthetic di-, tri-, and tetrapeptides studied by the same research group. These compounds share a common rationale: that small fragments of tissue-derived proteins can retain biological activity and can be produced reproducibly. The category as a whole remains outside mainstream pharmacological consensus, and epitalon specifically has a limited presence in independent, non-Russian research literature, which shapes how its evidence base is described.
During Rush's European leg of the Clockwork Angels Tour, the June 8, 2013, show at the Sweden Rock Festival was the group's first festival appearance in 30 years. On August 31, 2011, Rush switched their American distribution from Atlantic Records to the Warner Brothers majority-owned metal label Roadrunner Records. Roadrunner handled American distribution of Time Machine 2011: Live in Cleveland and Clockwork Angels. Anthem/Universal Music would continue to release their music in Canada. On April 18, 2013, Rush were inducted into the Rock and Roll Hall of Fame in Cleveland, Ohio.
A remnant of a Green Mountain Boys flag, believed to have belonged to John Stark, is owned by the Bennington Museum. It still exists as one of the few regimental flags from the time of the American Revolution. Although Stark was at the Battle of Bennington and likely flew this flag, the battle has become more commonly associated with the Bennington flag, which is believed to be a 19th-century banner.
(Endogastric means the shell is curved so as the ventral or lower side is longitudinally concave (abdomen in); exogastric means the shell is curved so as the ventral side is longitudinally convex (abdomen out) allowing the funnel to be pointed backward beneath the shell.)
Sources: en.wikipedia.org
== PhIP and cooking methods == Studies examining the amount of PhIP in cooked meats have shown that high levels of exposure are possible. Doneness levels of meat (rare, medium, well-done, and very well-done) are factors in the development of PhIP. Methods to reduce formation of PhIP in meats include decreasing the temperature at which the meat is cooked, decreasing the length of cooking time, pre-heating meat in the microwave oven (which reduces creatine), and marinating the meat.
Miraculin is a taste modifier, a glycoprotein extracted from the fruit of Synsepalum dulcificum. The berry, also known as the miracle fruit, was documented by explorer Chevalier des Marchais, who searched for many different fruits during a 1725 excursion to its native West Africa. Miraculin itself does not taste sweet. When taste buds are exposed to miraculin, the protein binds to the sweetness receptors. This causes normally sour-tasting acidic foods, such as citrus, to be perceived as sweet. The effect can last for one or two hours.
thiol 1. Any of a class of organosulfur compounds consisting of a sulfur atom attached to a hydrogen atom and any other organic substituent, with the general formula R–SH. Thiols are the sulfur analogues of alcohols. Also thiol derivative and mercaptan. 2. The –SH functional group itself. Also sulfhydryl, sulfanyl, and mercapto.
American primary and secondary education, known in the U.S. as K–12 ("kindergarten through 12th grade"), is decentralized. School systems are operated by state, territorial, and sometimes municipal governments and regulated by the U.S. Department of Education. In general, children are required to attend school or an approved homeschool from the age of five or six (kindergarten or first grade) until they are 18 years old. This often brings students through the 12th grade, the final year of a U.S. high school, but some states and territories allow them to leave school earlier, at age 16 or 17. The U.S. spends more on education per student than any other country, an average of $18,614 per year per public elementary and secondary school student in 2020–2021. Among Americans age 25 and older, 92.2% graduated from high school, 62.7% attended some college, 37.7% earned a bachelor's degree, and 14.2% earned a graduate degree. The U.S. literacy rate is near-universal. The U.S. has produced the most Nobel Prize winners of any country, with 411 (having won 413 awards). U.S. tertiary or higher education has earned a global reputation. Many of the world's top universities, as listed by various ranking organizations, are in the United States, including 19 of the top 25. American higher education is dominated by state university systems, although the country's many private universities and colleges enroll about 20% of all American students. Local community colleges generally offer open admissions, lower tuition, and coursework leading to an associate degree or a non-degree certificate.
Sources: en.wikipedia.org
Central de Abasto (Mexico City), described as the world's largest wholesale market by land area in a major regional publication, with very large daily merchandise volumes. Birmingham Wholesale Markets are the largest combined wholesale fresh produce markets in the United Kingdom, with 90 trading units totalling 31,000 m2 (330,000 sq ft). Yiwu International Trade City (China), often described as the world's largest wholesale market for small commodities and a major node in global supply chains.
DiCaprio turned down the role of Anakin Skywalker in Star Wars: Episode II – Attack of the Clones (2002), feeling unprepared to "take that dive" at the time. His first film that year was the biopic Catch Me If You Can, based on the life of Frank Abagnale Jr., who before his 19th birthday committed check fraud to make millions in the 1960s. Directed by Steven Spielberg, the film was shot across 147 different locations in 52 days, making it "the most adventurous, super-charged movie-making" DiCaprio had experienced yet. The film received critical acclaim and grossed $355 million against a budget of $52 million, becoming his second highest-grossing release after Titanic. Roger Ebert praised his departure from dark and troubled characters, and two Entertainment Weekly critics in 2018 called it DiCaprio's best role, labeling him "delightfully persuasive, deceptive, flirtatious, and sometimes tragic—and we dare you to find a better role, if you can". DiCaprio received his third Golden Globe nomination for his performance in the film. Also in 2002, DiCaprio starred in Martin Scorsese's Gangs of New York, a historical drama set in the mid-19th century in the Five Points district of New York City. Scorsese initially struggled selling his idea of realizing the film until DiCaprio became interested in starring in the film, and thus Miramax Films got involved with financing the project. Nonetheless, production on the film was plagued by overshooting of budgets and producer-director disagreements, resulting in an eight-month shoot.
In late 2005, researchers at the University of Melbourne speculated that the perentie (Varanus giganteus), other species of monitors, and agamids may be somewhat venomous. The team believes that the immediate effects of bites from these lizards were caused by mild envenomation. Bites on human digits by a lace monitor (V. varius), a Komodo dragon, and a spotted tree monitor (V. timorensis) all produced similar effects: rapid swelling, localised disruption of blood clotting, and shooting pain up to the elbow, with some symptoms lasting for several hours. In 2009, the same researchers published further evidence demonstrating that Komodo dragons possess a venomous bite. MRI scans of a preserved skull showed the presence of two glands in the lower jaw. The researchers extracted one of these glands from the head of a terminally ill dragon in the Singapore Zoological Gardens, and found it secreted several different toxic proteins. The known functions of these proteins include inhibition of blood clotting, lowering of blood pressure, muscle paralysis, and the induction of hypothermia, leading to shock and loss of consciousness in envenomated prey. As a result of the discovery, the previous theory that bacteria were responsible for the deaths of Komodo victims was disputed.
== Modifications == The ribonucleosides adenosine, cytidine, guanosine, and uridine are all derivatives of β-d-ribofuranose. Metabolically important species that include phosphorylated ribose include ADP, ATP, coenzyme A, and NADH. cAMP and cGMP serve as secondary messengers in some signaling pathways and are also ribose derivatives. The ribose moiety appears in some pharmaceutical agents, including the antibiotics neomycin and paromomycin.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
Sources: en.wikipedia.org
Mass spectrometry provides the identity check, because the observed mass is compared with the theoretical mass of the AEDG sequence. Chromatography separates and quantifies impurities but does not by itself prove which peptide is present. The two techniques are normally used together.
Yes. Trifluoroacetate and acetate ions remain associated with the peptide after purification, so a weighed quantity of powder contains less peptide than the nominal mass suggests. Certificates that report net peptide content rather than raw weight are more directly comparable between suppliers.
Dilute aqueous solutions are less stable than the dry powder and are usually aliquoted and frozen to avoid repeated freeze–thaw cycles. Lyophilised material is best stored desiccated at −20 °C, protected from light. Working solutions are typically prepared fresh from a frozen aliquot.
No. Epithalamin is a heterogeneous peptide fraction obtained from pineal gland extract and contains many components. Epitalon is a single synthetic tetrapeptide with the sequence Ala-Glu-Asp-Gly. Researchers synthesised the shorter peptide while attempting to identify active sequences within the extract.